PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.000200.1
Common NameCsa_6G216960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 284aa    MW: 31933.4 Da    PI: 10.0189
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.000200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.41.3e-32867260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-.SSSTTEEEEEEES--SS-- CS
            WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkvers.aedpkvveitYegeHnhek 60
                    +Dg+nWrKYGqK+vkgse+prsYY+Ct+++Cpv+k+vers +++++++ei+Y+++Hnh+k
  Cucsa.000200.1  8 EDGFNWRKYGQKVVKGSENPRSYYKCTFPNCPVRKQVERSlNNNGQITEIVYKSKHNHPK 67
                    7**************************************934689*************85 PP

2WRKY101.26.2e-32160218159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy WrKYGqK+vkg+++prsYY+Ct++gC v+k++er+++d ++v++tYeg+Hnh+
  Cucsa.000200.1 160 LDDGYWWRKYGQKVVKGNPNPRSYYKCTYPGCGVRKHIERASHDFRAVVTTYEGKHNHD 218
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.7E-29768IPR003657WRKY domain
SMARTSM007741.8E-37767IPR003657WRKY domain
SuperFamilySSF1182901.11E-25768IPR003657WRKY domain
PfamPF031062.1E-26866IPR003657WRKY domain
PROSITE profilePS5081124.501868IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.1E-34145220IPR003657WRKY domain
SuperFamilySSF1182905.1E-28152220IPR003657WRKY domain
PROSITE profilePS5081135.657155220IPR003657WRKY domain
SMARTSM007741.2E-35160219IPR003657WRKY domain
PfamPF031067.5E-24161218IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MRNRSGSEDG FNWRKYGQKV VKGSENPRSY YKCTFPNCPV RKQVERSLNN NGQITEIVYK  60
SKHNHPKPDF TRRSSSSFSS SSSSSSFEPA QLKSSIPSHS VTTPENSSIT IGDDHSDQAH  120
PRRWKSESSE KEEMIRGGGG VKTMREERIV VQTISNVDKL DDGYWWRKYG QKVVKGNPNP  180
RSYYKCTYPG CGVRKHIERA SHDFRAVVTT YEGKHNHDIP TARAGKPILS NQQGRNNEVA  240
SSSIGGDPRS SSKICSGTNG LLRLTNMLWN NKEEVVDNIY ELL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-368220877Probable WRKY transcription factor 4
2lex_A1e-368220877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9840300.0GU984030.1 Cucumis sativus WRKY protein (WRKY38) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001274406.11e-161probable WRKY transcription factor 33-like
SwissprotQ8S8P51e-79WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A0A0KCF60.0A0A0A0KCF6_CUCSA; Uncharacterized protein
STRINGOB01G44510.11e-86(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF107734114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-75WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]